YALI0F18502g


similar to uniprot|P23337 Saccharomyces cerevisiae YFR015c GSY1 UDP glucose--starch glucosyltransferase isoform 1 or uniprot|P27472 Saccharomyces cerevisiae YLR258w GSY2 UDP-glucose--starch glucosyltransferase isoform 2

Genomic environment map

Element type: CDS
Element length: 2073 nucleotides,
on sense strand of
Yali0F: 2472418..2474490.
Other names:
YALI-CDS1194.1
YALI-IPF1251
Coding sequence: 691 codons.
Database cross references:
EMBL: CR382132
GeneID: 2907835
GenomeReviews: CR382132_GR
HOGENOM: HBG330297

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R0629
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0F18502p  


similar to uniprot|P23337 Saccharomyces cerevisiae YFR015c GSY1 UDP glucose--starch glucosyltransferase isoform 1 or uniprot|P27472 Saccharomyces cerevisiae YLR258w GSY2 UDP-glucose--starch glucosyltransferase isoform 2; SubName: Full=YALI0F18502p;

Protein domain map

Protein length: 690 amino acids
Protein family: GL3R0629
Database cross references:
InterPro: IPR008631
KEGG: yli:YALI0F18502g
PANTHER: PTHR10176
Pfam: PF05693
RefSeq: XP_505581.1
UniProtKB/TrEMBL: Q6C181
UniProtKB: Q6C181_YARLI

Phylogeny  

PhylomeDB:YALI0F18502g

Computed results for YALI0F18502p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0F18502g.nt
ATGACGAGGGACACACGAAACCACCTGCTGTTCGAGGTCGCCACCGAGGTCGCCAACCGG
GTCGGCGGAATCTACTCGGTCATCAAGTCCAAGGCCCCCGTCACCGTCTACGAGTACGGG
GACCGGTACCACCTGATTGGACCCCTCAACCGCAAGTCGGCCGACATTGAGGTGGAGGAG
ATCACCGACGAGTCCCAGATTCCCGAAGCCATCAACAAAACACTAAAGTCCATGGCGGAA
CGAGGCATCCAGTACGTCTACGGCCGATGGCTCATTGAGGGCGCTCCCCGAGTCATTCTC
TTCGACCTGGGCTCCGCCTGGGGCTACCTTCCCGAGTGGAAGAGTGATCTGTGGACTGTG
GCCGGTATCCCCGCCCCCGAGGGCGACAAGGAGTCCAACGACGCCGTTGTGTTGGGCTAC
TTGGTGGCCTGGTTCCTGGGAGAGCTGACCACCCACGAAACCGAGCGGGCCGTCATTGCC
CACTTCCACGAGTGGCTGTCCGGTATTGCTCTGCCTCTGTGCAAAAAGCGACGAATCGAC
TGCACCACCATCTTCACCACACACGCTACTCTGCTGGGCCGATACCTGTGCGCCGGCTCG
GTCGACTTCTACAACAACCTGCAGGGCTTCGACGTGGACGCCGAGGCCGGAAAGCGAGGC
ATCTACCACCGATATTGCATTGAGCGGGCGGCTTCCCACTCGGCCGACGTTTTCACCACC
GTGTCGCACATCACCGCCTACGAGTCCGAGCACCTGCTCAAGCGAAAGCCCGACGGTGTG
GTGCCCAACGGTCTCAACGTGGTCAAGTTTTCGGCCATGCACGAGTTCCAGAACCTGCAT
GCCCTGATGAAGGACAAGATCAACCAGTTTGTCAAGGGCCACTTTTACGGTCACCTGGAC
TTTGATCTCGACGACACTCTGTATACCTTTACTGCCGGCCGATACGAGTACCGAAACAAG
GGTGTAGACATGTTCATCGAGTCTCTCGCCCGTCTCAACCACAGATTGAAGAGTGAGAAG
TCCACCAAGACCATTGTGGCCTTTATCATCATGCCCGCCCAGACCTCATCATACACAGTG
GAGACCCTCAAGGGCCAGGCCGTTATGAAGGCTCTGGAGGACACCGTCAACGAAATCCAG
CAGCAGATTGGCCGACGAATGCTCGACCATTGTGCCCGCCACAACAGCCACGACGGAAAG
GAGATCCCCGGCCTCGACCAGCTGCTTTCCCCCTCCGACAGAGTGCTGCTCAAGCGACGA
GTGTTTGCCCTCAAGCGAGAAACCTTCCCTCCCATTGTCACCCACAACATGGTGGACGAC
TCCACAGACCCCATTCTCAACCAGATCCGACGGGTACAGCTGTTCAACCGGCCCGAGGAC
CGGGTCAAGATTATCTTCCACCCCGAGTTCCTCAACTCCAACAACCCTATCCTGCCTCTC
GACTACGACGACTTTGTGCGAGGCTGTCATCTCGGAGTCTTCCCCTCCTACTACGAGCCT
TGGGGATACACCCCCGCCGAGTGCACCGTCATGGGCGTTCCTTCCATCACCACCAACCTC
TCTGGTTTCGGCTGCTACATGGAGGATCTCATTGAGAACGCCTCCGACTACGGCATCTAC
ATTGTGGACCGTCGTCTCAAGTCTATTGACGAGAGTGTTGACCAGCTAACCGACTACATG
TTTGAGTTCTCCAAGAAGTCGCGACGTCAGCGAATTAACCAGCGAAACCGAACCGAGCGA
CTGTCCGATCTGCTGGACTGGAAGCGAATGGGCCGAGAGTACATCAAGGCTCGACAGCTG
GCTCTTCGACGAGCCTACCCCGACCAGTTTGACCACGAGGAGAACCCCTTCGAAGACGAG
GAGCCTCTCAAGCTGACTCGACCTCTATCTGTGCCTGGATCCCCCCGTGACCGAGCCGGT
CTCATGACTCCCGGTGATCTTGGATCTCTGGGTGAGATTGGCGAGGGTCTTGACACTGAC
GATTATGTGGGCTTCCGACTTCCCCAGGATGATGATGACGAGGAGGAGACTAGCTACCCT
GCCACTCTCACTCTAGCCGGTAGCAGAAAGTAG

Coding sequence    

>YALI0F18502g.cds
ATGACGAGGGACACACGAAACCACCTGCTGTTCGAGGTCGCCACCGAGGTCGCCAACCGG
GTCGGCGGAATCTACTCGGTCATCAAGTCCAAGGCCCCCGTCACCGTCTACGAGTACGGG
GACCGGTACCACCTGATTGGACCCCTCAACCGCAAGTCGGCCGACATTGAGGTGGAGGAG
ATCACCGACGAGTCCCAGATTCCCGAAGCCATCAACAAAACACTAAAGTCCATGGCGGAA
CGAGGCATCCAGTACGTCTACGGCCGATGGCTCATTGAGGGCGCTCCCCGAGTCATTCTC
TTCGACCTGGGCTCCGCCTGGGGCTACCTTCCCGAGTGGAAGAGTGATCTGTGGACTGTG
GCCGGTATCCCCGCCCCCGAGGGCGACAAGGAGTCCAACGACGCCGTTGTGTTGGGCTAC
TTGGTGGCCTGGTTCCTGGGAGAGCTGACCACCCACGAAACCGAGCGGGCCGTCATTGCC
CACTTCCACGAGTGGCTGTCCGGTATTGCTCTGCCTCTGTGCAAAAAGCGACGAATCGAC
TGCACCACCATCTTCACCACACACGCTACTCTGCTGGGCCGATACCTGTGCGCCGGCTCG
GTCGACTTCTACAACAACCTGCAGGGCTTCGACGTGGACGCCGAGGCCGGAAAGCGAGGC
ATCTACCACCGATATTGCATTGAGCGGGCGGCTTCCCACTCGGCCGACGTTTTCACCACC
GTGTCGCACATCACCGCCTACGAGTCCGAGCACCTGCTCAAGCGAAAGCCCGACGGTGTG
GTGCCCAACGGTCTCAACGTGGTCAAGTTTTCGGCCATGCACGAGTTCCAGAACCTGCAT
GCCCTGATGAAGGACAAGATCAACCAGTTTGTCAAGGGCCACTTTTACGGTCACCTGGAC
TTTGATCTCGACGACACTCTGTATACCTTTACTGCCGGCCGATACGAGTACCGAAACAAG
GGTGTAGACATGTTCATCGAGTCTCTCGCCCGTCTCAACCACAGATTGAAGAGTGAGAAG
TCCACCAAGACCATTGTGGCCTTTATCATCATGCCCGCCCAGACCTCATCATACACAGTG
GAGACCCTCAAGGGCCAGGCCGTTATGAAGGCTCTGGAGGACACCGTCAACGAAATCCAG
CAGCAGATTGGCCGACGAATGCTCGACCATTGTGCCCGCCACAACAGCCACGACGGAAAG
GAGATCCCCGGCCTCGACCAGCTGCTTTCCCCCTCCGACAGAGTGCTGCTCAAGCGACGA
GTGTTTGCCCTCAAGCGAGAAACCTTCCCTCCCATTGTCACCCACAACATGGTGGACGAC
TCCACAGACCCCATTCTCAACCAGATCCGACGGGTACAGCTGTTCAACCGGCCCGAGGAC
CGGGTCAAGATTATCTTCCACCCCGAGTTCCTCAACTCCAACAACCCTATCCTGCCTCTC
GACTACGACGACTTTGTGCGAGGCTGTCATCTCGGAGTCTTCCCCTCCTACTACGAGCCT
TGGGGATACACCCCCGCCGAGTGCACCGTCATGGGCGTTCCTTCCATCACCACCAACCTC
TCTGGTTTCGGCTGCTACATGGAGGATCTCATTGAGAACGCCTCCGACTACGGCATCTAC
ATTGTGGACCGTCGTCTCAAGTCTATTGACGAGAGTGTTGACCAGCTAACCGACTACATG
TTTGAGTTCTCCAAGAAGTCGCGACGTCAGCGAATTAACCAGCGAAACCGAACCGAGCGA
CTGTCCGATCTGCTGGACTGGAAGCGAATGGGCCGAGAGTACATCAAGGCTCGACAGCTG
GCTCTTCGACGAGCCTACCCCGACCAGTTTGACCACGAGGAGAACCCCTTCGAAGACGAG
GAGCCTCTCAAGCTGACTCGACCTCTATCTGTGCCTGGATCCCCCCGTGACCGAGCCGGT
CTCATGACTCCCGGTGATCTTGGATCTCTGGGTGAGATTGGCGAGGGTCTTGACACTGAC
GATTATGTGGGCTTCCGACTTCCCCAGGATGATGATGACGAGGAGGAGACTAGCTACCCT
GCCACTCTCACTCTAGCCGGTAGCAGAAAGTAG

Predicted translation product    

>YALI0F18502g.aa
MTRDTRNHLLFEVATEVANRVGGIYSVIKSKAPVTVYEYGDRYHLIGPLNRKSADIEVEE
ITDESQIPEAINKTLKSMAERGIQYVYGRWLIEGAPRVILFDLGSAWGYLPEWKSDLWTV
AGIPAPEGDKESNDAVVLGYLVAWFLGELTTHETERAVIAHFHEWLSGIALPLCKKRRID
CTTIFTTHATLLGRYLCAGSVDFYNNLQGFDVDAEAGKRGIYHRYCIERAASHSADVFTT
VSHITAYESEHLLKRKPDGVVPNGLNVVKFSAMHEFQNLHALMKDKINQFVKGHFYGHLD
FDLDDTLYTFTAGRYEYRNKGVDMFIESLARLNHRLKSEKSTKTIVAFIIMPAQTSSYTV
ETLKGQAVMKALEDTVNEIQQQIGRRMLDHCARHNSHDGKEIPGLDQLLSPSDRVLLKRR
VFALKRETFPPIVTHNMVDDSTDPILNQIRRVQLFNRPEDRVKIIFHPEFLNSNNPILPL
DYDDFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEDLIENASDYGIY
IVDRRLKSIDESVDQLTDYMFEFSKKSRRQRINQRNRTERLSDLLDWKRMGREYIKARQL
ALRRAYPDQFDHEENPFEDEEPLKLTRPLSVPGSPRDRAGLMTPGDLGSLGEIGEGLDTD
DYVGFRLPQDDDDEEETSYPATLTLAGSRK*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites