YALI0F08415g


similar to wi|NCU00678.1 Neurospora crassa and uniprot|Q04792 Saccharomyces cerevisiae YMR250w

Genomic environment map

Element type: CDS
Element length: 1635 nucleotides,
on sense strand of
Yali0F: 1182607..1184241.
Other names:
YALI-CDS1997.1
YALI-IPF2030
Coding sequence: 545 codons.
Database cross references:
EMBL: CR382132
GeneID: 2908500
GenomeReviews: CR382132_GR
HOGENOM: HBG365574

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0464
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0F08415p  


similar to wi|NCU00678.1 Neurospora crassa and uniprot|Q04792 Saccharomyces cerevisiae YMR250w; SubName: Full=YALI0F08415p;

Protein domain map

Protein length: 544 amino acids
Protein family: GL3C0464
Database cross references:
Gene3D: G3DSA:3.40.640.10
InterPro: IPR002129
InterPro: IPR010107
InterPro: IPR015421
InterPro: IPR015424
KEGG: yli:YALI0F08415g
PANTHER: PTHR11999
PANTHER: PTHR11999:SF1
Pfam: PF00282
RefSeq: XP_505160.1
TIGRFAMs: TIGR01788
UniProtKB/TrEMBL: Q6C2F2
UniProtKB: Q6C2F2_YARLI

Phylogeny  

PhylomeDB:YALI0F08415g

Computed results for YALI0F08415p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0F08415g.nt
ATGGTCCTCTCCGAACACGTCAACGCCGACAAGCTGCTGTCCAACCTCACCGGCAAGGGT
GACGAGCACGCCATCCGGGCTCTCATTGCCTCCCACACCCTGCGAGACCCCTACTCATCC
AAGTACAACTCGCAGGAGCCCATTCCCAAGTTCCGAATTCCCGAGGAGGGCTGCGAGGAG
AAGCAGGCCTACCAGCTTATTAAGGATGACCTGGATCTCGACGGAAAGCCCAACCTCAAC
CTGGCTTCTTTCGTCAACACCTACATCTCCGACCGAGCCGAGAAGCTGGCCGTGGAGAAC
CTGACCAAGAACCTGGCCGATGCCGACGAGTACCCCGCTCTGATGACCGTTCACGCCCGA
TGTGTCTCCATTCTCGGCCATCTCTGGAACAACACCGACCACGAGAAAGCTATCGGTACT
GCCACCACCGGATCTTCCGAGGCCATCCATCTTGGAGGTCTGGCCATGAAGAAGCGATGG
CAGGAGAAGCGACGGGCCGCCGGCAAGTCCACTGAGAAGCCTAACATTCTCATGGCTGCC
AACGCCCAGGTCGCCCTCGAGAAGTTTGCCCGATACTTTGATGTCGAGGACCGAATCATC
CCCGTGCGAGAGGCCTCCAAGCACTGCCTCGATCTGTCCAAGATCAAGGAGAACCTCGAT
GAGAACACCATTGGTATCTTCGTCATCATGGGATCCACCTACACTGGCCACTACGAAGAC
GTCCAGGGCGTCGCCAAGATTTTGGATGAGTACGAGAAGGAGACCGGTCACTCCATTGAC
ATCCACGTTGACGGAGCCTCCGGAGCCATGGTTGCCCCTTTCCTCTACCCCGATCTCGAG
TGGGACTTCCGAGTGCCCCGAGTCAAGTCCATCAACACCTCTGGCCACAAGTTTGGTCTC
ACAACCGCTGGTCTTGGTTGGATTCTCTGGAGAGACGCAAAGTACCTGCCCAAGGAGCTC
ATCTTCGAGCTGCACTACCTGGGAGGTAAGGAGGAGTCCTACACCCTCAACTTCTCGAGA
CCCGGTTTCCCCGTGCTGCACCAGTACTACAACTTCCTGCACCTGGGATTCGACGGCTAC
AAGCAGCTGCATGCCTCTTCCATGGCTAACGCCCGACTGCTATCTGTCTTCCTCGAGGCT
ACTGGACACTACACTTGCGTCTCCGAGATCCACCTGCCTGCTAATGGCTCCAAGCCCAAG
GATGTCAAGCACGTGGCTACTGCCGATCCTCTGCAGTACATGGCTGGTCTGCCCGTTGTT
GCCTTCCGATTCTCCGACTCGTTCCGAAAGGCACATCCTGAGGTCCCCCAGGCTGCTGTC
TCCACCCTGCTACGAGTCAAGGGATACATTATCCCCAACTACGAGCTGCCTCCTTCCGAG
CAGAAGACTGAGATTCTTCGAGTGGTTGTGCGACAGTCCATGTCCATCGACCTGCTCGAC
CGACTCATGGAGGACATTTCCGCCATCACCAATGTGCTGCTCGAGGCCGTGGAGGATGTG
AAGAAGCTGCGGGCCGAGGGTGACCACGATCCTCAGCTCATTCACAAGTACGTTCTGACT
CTGGTGACCGGAAAGCCTGTTGAGGAGCGAGAGGAGGACTGGGAGGGACACTCCACTTTC
CGAGCTGCCTGTTAA

Coding sequence    

>YALI0F08415g.cds
ATGGTCCTCTCCGAACACGTCAACGCCGACAAGCTGCTGTCCAACCTCACCGGCAAGGGT
GACGAGCACGCCATCCGGGCTCTCATTGCCTCCCACACCCTGCGAGACCCCTACTCATCC
AAGTACAACTCGCAGGAGCCCATTCCCAAGTTCCGAATTCCCGAGGAGGGCTGCGAGGAG
AAGCAGGCCTACCAGCTTATTAAGGATGACCTGGATCTCGACGGAAAGCCCAACCTCAAC
CTGGCTTCTTTCGTCAACACCTACATCTCCGACCGAGCCGAGAAGCTGGCCGTGGAGAAC
CTGACCAAGAACCTGGCCGATGCCGACGAGTACCCCGCTCTGATGACCGTTCACGCCCGA
TGTGTCTCCATTCTCGGCCATCTCTGGAACAACACCGACCACGAGAAAGCTATCGGTACT
GCCACCACCGGATCTTCCGAGGCCATCCATCTTGGAGGTCTGGCCATGAAGAAGCGATGG
CAGGAGAAGCGACGGGCCGCCGGCAAGTCCACTGAGAAGCCTAACATTCTCATGGCTGCC
AACGCCCAGGTCGCCCTCGAGAAGTTTGCCCGATACTTTGATGTCGAGGACCGAATCATC
CCCGTGCGAGAGGCCTCCAAGCACTGCCTCGATCTGTCCAAGATCAAGGAGAACCTCGAT
GAGAACACCATTGGTATCTTCGTCATCATGGGATCCACCTACACTGGCCACTACGAAGAC
GTCCAGGGCGTCGCCAAGATTTTGGATGAGTACGAGAAGGAGACCGGTCACTCCATTGAC
ATCCACGTTGACGGAGCCTCCGGAGCCATGGTTGCCCCTTTCCTCTACCCCGATCTCGAG
TGGGACTTCCGAGTGCCCCGAGTCAAGTCCATCAACACCTCTGGCCACAAGTTTGGTCTC
ACAACCGCTGGTCTTGGTTGGATTCTCTGGAGAGACGCAAAGTACCTGCCCAAGGAGCTC
ATCTTCGAGCTGCACTACCTGGGAGGTAAGGAGGAGTCCTACACCCTCAACTTCTCGAGA
CCCGGTTTCCCCGTGCTGCACCAGTACTACAACTTCCTGCACCTGGGATTCGACGGCTAC
AAGCAGCTGCATGCCTCTTCCATGGCTAACGCCCGACTGCTATCTGTCTTCCTCGAGGCT
ACTGGACACTACACTTGCGTCTCCGAGATCCACCTGCCTGCTAATGGCTCCAAGCCCAAG
GATGTCAAGCACGTGGCTACTGCCGATCCTCTGCAGTACATGGCTGGTCTGCCCGTTGTT
GCCTTCCGATTCTCCGACTCGTTCCGAAAGGCACATCCTGAGGTCCCCCAGGCTGCTGTC
TCCACCCTGCTACGAGTCAAGGGATACATTATCCCCAACTACGAGCTGCCTCCTTCCGAG
CAGAAGACTGAGATTCTTCGAGTGGTTGTGCGACAGTCCATGTCCATCGACCTGCTCGAC
CGACTCATGGAGGACATTTCCGCCATCACCAATGTGCTGCTCGAGGCCGTGGAGGATGTG
AAGAAGCTGCGGGCCGAGGGTGACCACGATCCTCAGCTCATTCACAAGTACGTTCTGACT
CTGGTGACCGGAAAGCCTGTTGAGGAGCGAGAGGAGGACTGGGAGGGACACTCCACTTTC
CGAGCTGCCTGTTAA

Predicted translation product    

>YALI0F08415g.aa
MVLSEHVNADKLLSNLTGKGDEHAIRALIASHTLRDPYSSKYNSQEPIPKFRIPEEGCEE
KQAYQLIKDDLDLDGKPNLNLASFVNTYISDRAEKLAVENLTKNLADADEYPALMTVHAR
CVSILGHLWNNTDHEKAIGTATTGSSEAIHLGGLAMKKRWQEKRRAAGKSTEKPNILMAA
NAQVALEKFARYFDVEDRIIPVREASKHCLDLSKIKENLDENTIGIFVIMGSTYTGHYED
VQGVAKILDEYEKETGHSIDIHVDGASGAMVAPFLYPDLEWDFRVPRVKSINTSGHKFGL
TTAGLGWILWRDAKYLPKELIFELHYLGGKEESYTLNFSRPGFPVLHQYYNFLHLGFDGY
KQLHASSMANARLLSVFLEATGHYTCVSEIHLPANGSKPKDVKHVATADPLQYMAGLPVV
AFRFSDSFRKAHPEVPQAAVSTLLRVKGYIIPNYELPPSEQKTEILRVVVRQSMSIDLLD
RLMEDISAITNVLLEAVEDVKKLRAEGDHDPQLIHKYVLTLVTGKPVEEREEDWEGHSTF
RAAC*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites