YALI0E22715g


weakly similar to uniprot|Q04089 Saccharomyces cerevisiae YDR440w DOT1 putative ATPase

Genomic environment map

Element type: CDS
Element length: 1479 nucleotides,
on sense strand of
Yali0E: 2681852..2683330.
Other names:
YALI-CDS2413.1
YALI-IPF3460
Coding sequence: 493 codons.
Database cross references:
EMBL: CR382131
GeneID: 2912906
GenomeReviews: CR382131_GR

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C2781
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0E22715p  


weakly similar to uniprot|Q04089 Saccharomyces cerevisiae YDR440w DOT1 putative ATPase; RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-79 specific; EC=2.1.1.43; AltName: Full=Histone H3-K79 methyltransferase; Short=H3-K79-HMTase;

Protein domain map

Protein length: 492 amino acids
Protein family: GL3C2781
Database cross references:
HSSP: 1U2Z
HSSP: Q04089
InterPro: IPR013110
InterPro: IPR021162
KEGG: yli:YALI0E22715g
PIRSF: PIRSF017570
Pfam: PF08123
RefSeq: XP_504277.1
UniProtKB/Swiss-Prot: Q6C4Y5
UniProtKB: DOT1_YARLI

Computed results for YALI0E22715p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0E22715g.nt
ATGTTCTTCTCGCATCTCGGAAAGAAGAACGGCGGCCCTACAGCAAAGTCTTCCGATGTC
AAACGCAAAGTGACCAAGGTCAAAACCCGCAAGCCAGTGGTTACGTCGGTTTCCAAATCG
CCGTCTCCTAGTAAGACGGCTCCTCCACCCGCCACAGCAGCAGCAGCAGCAACAGCAGCA
GCCAAGCCTTCGACGCCTCGAAAAAGTCGACGAAAGACGCCAAACATTTACCAGCTGTCG
AAGAGCTCGTTGTCCGAGGTAGACACTGAAGAAAGTGAGCGTGAAGTGAGCTCTTCTCTC
TCAACTCCGGGGCTCTATGAACTCGTGCCCCGAGATATTGTGACAGCTGGCTTTGGATCG
GCCGAACTCGCCACCTCCATCCACATCACTAACGCCTCCGAATCGGGCAACTTGAGCATG
ACGGACATTTACGAGCCCGTGTCGACCGACAAGTCGCTCAGTGACCGGGTGAAACTGGGG
GCACTGTCATGTGACTTCGTCGAGGACTACAGTCTCATCAAACCCAAGGTCCCCGGCGAG
TTTGAGCCCGTGCGAGAGATTCTCAGCATTATGGAAATGACAGCTCTGCATTTCGTGGAC
AAGGGCGCGTCGGAGGAAATCAAACATCCGGTCATGGATGACTGCATCATGAGACGGTTC
AGACGATCGTACGAGGGAGGCGATCTGGAAGGCATGAAGACTTCCATGAAGGAGTTTGAC
GAGGTGGTGAAGACACAGCGAGCCGAGGGCGCCATTCTGGCCAACCTCAAACAGCTCACT
GCAGTACCTCAGGACCTAGCATACTTTCTACTCAACCAGGTGTACAGCCGAATCGTGTCG
CCGGAATCTAAAAGCCTACGGGACTACAAGGCATTTTCCAACAACGTCTACGGCGAACTC
ATGCCCCCATTCATGTCCACAGTGTTCCAGAAGACAGACTTGCAGCCCAGTTCTGTGTTT
GTGGACCTTGGATCGGGAGTGGGAAACTGCACATTACAGGCTGCTTTGGAGGTGGGCTGC
GAGAGTTGGGGATGCGAAGTGATGACCAACGCTTCGAGTCTGGCAGAAAAGCAGAAAATA
GAGCTTTACAGTCGGGCCAAGATGTTTGGAATCAAGACCGGAGACATTCATTTGGTGGCG
AGTAGTTTTGTGCATAACGACGAGGTGCATTCGGCCATCTCTCGCGCAGATGTATTGCTG
GTAAATAACTATGCATTTGACGGCACTCTCAACGCGCATTTGCTAGACATGTTTTTGGAT
CTCAAGGAGGGATGCAAGATTGTTTCGCTCAAGTCGTTTGTGCCAGTAGGCCATGTCATT
TCCGAACATAACATTGAGTCGCCTGTCAACATTTTGAAGGTACAAAAGTTGGACTTTTAC
TCGGGCTCCGTCTCCTGGACGGCTGCAGGAGGAACATATTACATTTCGACCGTGGACAGA
AGTGCCATCAAGGCGTTTTTGTCGAAGGGTGGATATTAA

Coding sequence    

>YALI0E22715g.cds
ATGTTCTTCTCGCATCTCGGAAAGAAGAACGGCGGCCCTACAGCAAAGTCTTCCGATGTC
AAACGCAAAGTGACCAAGGTCAAAACCCGCAAGCCAGTGGTTACGTCGGTTTCCAAATCG
CCGTCTCCTAGTAAGACGGCTCCTCCACCCGCCACAGCAGCAGCAGCAGCAACAGCAGCA
GCCAAGCCTTCGACGCCTCGAAAAAGTCGACGAAAGACGCCAAACATTTACCAGCTGTCG
AAGAGCTCGTTGTCCGAGGTAGACACTGAAGAAAGTGAGCGTGAAGTGAGCTCTTCTCTC
TCAACTCCGGGGCTCTATGAACTCGTGCCCCGAGATATTGTGACAGCTGGCTTTGGATCG
GCCGAACTCGCCACCTCCATCCACATCACTAACGCCTCCGAATCGGGCAACTTGAGCATG
ACGGACATTTACGAGCCCGTGTCGACCGACAAGTCGCTCAGTGACCGGGTGAAACTGGGG
GCACTGTCATGTGACTTCGTCGAGGACTACAGTCTCATCAAACCCAAGGTCCCCGGCGAG
TTTGAGCCCGTGCGAGAGATTCTCAGCATTATGGAAATGACAGCTCTGCATTTCGTGGAC
AAGGGCGCGTCGGAGGAAATCAAACATCCGGTCATGGATGACTGCATCATGAGACGGTTC
AGACGATCGTACGAGGGAGGCGATCTGGAAGGCATGAAGACTTCCATGAAGGAGTTTGAC
GAGGTGGTGAAGACACAGCGAGCCGAGGGCGCCATTCTGGCCAACCTCAAACAGCTCACT
GCAGTACCTCAGGACCTAGCATACTTTCTACTCAACCAGGTGTACAGCCGAATCGTGTCG
CCGGAATCTAAAAGCCTACGGGACTACAAGGCATTTTCCAACAACGTCTACGGCGAACTC
ATGCCCCCATTCATGTCCACAGTGTTCCAGAAGACAGACTTGCAGCCCAGTTCTGTGTTT
GTGGACCTTGGATCGGGAGTGGGAAACTGCACATTACAGGCTGCTTTGGAGGTGGGCTGC
GAGAGTTGGGGATGCGAAGTGATGACCAACGCTTCGAGTCTGGCAGAAAAGCAGAAAATA
GAGCTTTACAGTCGGGCCAAGATGTTTGGAATCAAGACCGGAGACATTCATTTGGTGGCG
AGTAGTTTTGTGCATAACGACGAGGTGCATTCGGCCATCTCTCGCGCAGATGTATTGCTG
GTAAATAACTATGCATTTGACGGCACTCTCAACGCGCATTTGCTAGACATGTTTTTGGAT
CTCAAGGAGGGATGCAAGATTGTTTCGCTCAAGTCGTTTGTGCCAGTAGGCCATGTCATT
TCCGAACATAACATTGAGTCGCCTGTCAACATTTTGAAGGTACAAAAGTTGGACTTTTAC
TCGGGCTCCGTCTCCTGGACGGCTGCAGGAGGAACATATTACATTTCGACCGTGGACAGA
AGTGCCATCAAGGCGTTTTTGTCGAAGGGTGGATATTAA

Predicted translation product    

>YALI0E22715g.aa
MFFSHLGKKNGGPTAKSSDVKRKVTKVKTRKPVVTSVSKSPSPSKTAPPPATAAAAATAA
AKPSTPRKSRRKTPNIYQLSKSSLSEVDTEESEREVSSSLSTPGLYELVPRDIVTAGFGS
AELATSIHITNASESGNLSMTDIYEPVSTDKSLSDRVKLGALSCDFVEDYSLIKPKVPGE
FEPVREILSIMEMTALHFVDKGASEEIKHPVMDDCIMRRFRRSYEGGDLEGMKTSMKEFD
EVVKTQRAEGAILANLKQLTAVPQDLAYFLLNQVYSRIVSPESKSLRDYKAFSNNVYGEL
MPPFMSTVFQKTDLQPSSVFVDLGSGVGNCTLQAALEVGCESWGCEVMTNASSLAEKQKI
ELYSRAKMFGIKTGDIHLVASSFVHNDEVHSAISRADVLLVNNYAFDGTLNAHLLDMFLD
LKEGCKIVSLKSFVPVGHVISEHNIESPVNILKVQKLDFYSGSVSWTAAGGTYYISTVDR
SAIKAFLSKGGY*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites