YALI0E20207g


weakly similar to uniprot|P04807 Saccharomyces cerevisiae YGL253w HXK2 hexokinase II

Genomic environment map

Element type: CDS
Element length: 1395 nucleotides,
on sense strand of
Yali0E: 2398147..2399541.
Other names:
YALI-CDS2655.1
YALI-IPF3347
Coding sequence: 465 codons.
Database cross references:
EMBL: CR382131
GeneID: 2911808
GenomeReviews: CR382131_GR

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0087
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0E20207p  


weakly similar to uniprot|P04807 Saccharomyces cerevisiae YGL253w HXK2 hexokinase II; SubName: Full=YALI0E20207p;

Protein domain map

Protein length: 464 amino acids
Protein family: GL3C0087
Database cross references:
InterPro: IPR001312
InterPro: IPR022672
InterPro: IPR022673
KEGG: yli:YALI0E20207g
PANTHER: PTHR19443
PRINTS: PR00475
Pfam: PF00349
Pfam: PF03727
RefSeq: XP_504178.1
UniProtKB/TrEMBL: Q6C584
UniProtKB: Q6C584_YARLI

Phylogeny  

PhylomeDB:YALI0E20207g

Computed results for YALI0E20207p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0E20207g.nt
ATGTCCATGGGAGATGACGACCGGGCGTACCATCATCAAATGTCTGTGATTGTAACCGCC
GCAAACGCCAACCTTCCCGGCCACGGCAAGGGCCCTCTGGTGTCGGTCTCCTCGGAGCTG
CTGACTAAAGAGTCTCATCTCATGTACGACTTTGAGCGCTACGTGGCTCGAAACCCGTCG
CGCTTCAACCAAAAGGTTCTCGACAACCTCCGCATTCACCACACATACACCCGCTCGTCT
CTGGACACTCTGGTGAACGAGTTTCTGGCAGAAATCACCCCCGCATGCGCCAACAGAGAC
GCCCCGTCCATGCTGCCGTCCAAGATGGGCTCGCTGCCCAACGACTCGCTGACGGGCTCG
GTGCTCTCCATCGACATTGGAGGCAGCACTCTCCGTGGCTCCATGGTCGATCTGGAGAAG
ATGACCGTCACGGACTCGGTCCAGCACCTCATCCCCGACACGGTCAAGAACTACTCGGGC
TCGGACTTTTTCGACTGGATCGTCGAGCGAATCATGCCTCTGGTCAAGGACTGCACAGCC
ACCATCATCCCCATCGGCCTGTCGTGGTCCTTCCCCATCTTCCAGCCCCACATCTCCTCA
GGCCTGATCCAGACCATGGGCAAGGGCTACGGAGTGGCAGACGAAATCATCAACCAGGAC
CTCAAGGAATTGTTCGAGACCCACTTTGCCTCTCACGGCAAGACCGTCGAGGTCGGCGCC
ATTCTCAATGATTCGGTGGCGTCTCTGGTGGCAGCCAACTACATTTCCAACGCTCCCCTG
TGTCTCATTCTCGGCACAGGCATCAACGTGTCTGCCCTGATCCCTAAAGACCAGCTCAAG
AAGACCGAGCAGGACCAGGACAAGTACATTGTCAACTGCGAGGCGTCTCTGTTTGGCCAG
TGTGTGTCCAAGACGTGCTGGGACCTGGAGCTAGACCAGGCTCTGGAGCGCCCTGGATTC
CAGCCTCTCGAGTCTCTGTCTTCCGGACGATACCTCGGCGAAATATGCAGACTGATTCTG
CGAGACTTGTCCAAGACGGGTTTCTTGAGCCGACCAGACGTCGGGCCCTACGAGCTGACA
ACCGCCGAAGTGGCTGATTTGGAGACCGCCGACTCGGGAGAGCTGGACTACGTGCAGGAC
ATCATTCTGGCCACCTCCGACCGGTCTGCCGCCCTGGCATCGGCCTTCATTACCGCCATT
TACAAGCTGACTGGTTCGGACTGCGAGTCGCCGTCCATTGCCTACGACGGCACCATGGTG
CAGAAGTACCCCAACTTCCGTCCTCGAATGCAGCAGCGACTTAGGGAGCAGGGCCTGAAC
GTGACATTTGTGGCTGTGGAAGAGGGCACCGTGTATGGCTCCGCCATTGCATGCGCCAGC
CAGCTTTCACAGTAG

Coding sequence    

>YALI0E20207g.cds
ATGTCCATGGGAGATGACGACCGGGCGTACCATCATCAAATGTCTGTGATTGTAACCGCC
GCAAACGCCAACCTTCCCGGCCACGGCAAGGGCCCTCTGGTGTCGGTCTCCTCGGAGCTG
CTGACTAAAGAGTCTCATCTCATGTACGACTTTGAGCGCTACGTGGCTCGAAACCCGTCG
CGCTTCAACCAAAAGGTTCTCGACAACCTCCGCATTCACCACACATACACCCGCTCGTCT
CTGGACACTCTGGTGAACGAGTTTCTGGCAGAAATCACCCCCGCATGCGCCAACAGAGAC
GCCCCGTCCATGCTGCCGTCCAAGATGGGCTCGCTGCCCAACGACTCGCTGACGGGCTCG
GTGCTCTCCATCGACATTGGAGGCAGCACTCTCCGTGGCTCCATGGTCGATCTGGAGAAG
ATGACCGTCACGGACTCGGTCCAGCACCTCATCCCCGACACGGTCAAGAACTACTCGGGC
TCGGACTTTTTCGACTGGATCGTCGAGCGAATCATGCCTCTGGTCAAGGACTGCACAGCC
ACCATCATCCCCATCGGCCTGTCGTGGTCCTTCCCCATCTTCCAGCCCCACATCTCCTCA
GGCCTGATCCAGACCATGGGCAAGGGCTACGGAGTGGCAGACGAAATCATCAACCAGGAC
CTCAAGGAATTGTTCGAGACCCACTTTGCCTCTCACGGCAAGACCGTCGAGGTCGGCGCC
ATTCTCAATGATTCGGTGGCGTCTCTGGTGGCAGCCAACTACATTTCCAACGCTCCCCTG
TGTCTCATTCTCGGCACAGGCATCAACGTGTCTGCCCTGATCCCTAAAGACCAGCTCAAG
AAGACCGAGCAGGACCAGGACAAGTACATTGTCAACTGCGAGGCGTCTCTGTTTGGCCAG
TGTGTGTCCAAGACGTGCTGGGACCTGGAGCTAGACCAGGCTCTGGAGCGCCCTGGATTC
CAGCCTCTCGAGTCTCTGTCTTCCGGACGATACCTCGGCGAAATATGCAGACTGATTCTG
CGAGACTTGTCCAAGACGGGTTTCTTGAGCCGACCAGACGTCGGGCCCTACGAGCTGACA
ACCGCCGAAGTGGCTGATTTGGAGACCGCCGACTCGGGAGAGCTGGACTACGTGCAGGAC
ATCATTCTGGCCACCTCCGACCGGTCTGCCGCCCTGGCATCGGCCTTCATTACCGCCATT
TACAAGCTGACTGGTTCGGACTGCGAGTCGCCGTCCATTGCCTACGACGGCACCATGGTG
CAGAAGTACCCCAACTTCCGTCCTCGAATGCAGCAGCGACTTAGGGAGCAGGGCCTGAAC
GTGACATTTGTGGCTGTGGAAGAGGGCACCGTGTATGGCTCCGCCATTGCATGCGCCAGC
CAGCTTTCACAGTAG

Predicted translation product    

>YALI0E20207g.aa
MSMGDDDRAYHHQMSVIVTAANANLPGHGKGPLVSVSSELLTKESHLMYDFERYVARNPS
RFNQKVLDNLRIHHTYTRSSLDTLVNEFLAEITPACANRDAPSMLPSKMGSLPNDSLTGS
VLSIDIGGSTLRGSMVDLEKMTVTDSVQHLIPDTVKNYSGSDFFDWIVERIMPLVKDCTA
TIIPIGLSWSFPIFQPHISSGLIQTMGKGYGVADEIINQDLKELFETHFASHGKTVEVGA
ILNDSVASLVAANYISNAPLCLILGTGINVSALIPKDQLKKTEQDQDKYIVNCEASLFGQ
CVSKTCWDLELDQALERPGFQPLESLSSGRYLGEICRLILRDLSKTGFLSRPDVGPYELT
TAEVADLETADSGELDYVQDIILATSDRSAALASAFITAIYKLTGSDCESPSIAYDGTMV
QKYPNFRPRMQQRLREQGLNVTFVAVEEGTVYGSAIACASQLSQ*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites