YALI0D21384g


weakly similar to uniprot|Q08387 Saccharomyces cerevisiae YOR005c DNL4 DNA ligase IV

Genomic environment map

Element type: CDS
Element length: 2871 nucleotides,
on anti-sense strand of
Yali0D: complement(2708566..2711436).
Other names:
YALI-CDS0510.1
YALI-IPF5817
Coding sequence: 957 codons.
Database cross references:
EMBL: CR382130
GeneID: 2911076
GenomeReviews: CR382130_GR
HOGENOM: HBG272039

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0416
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0D21384p  


weakly similar to uniprot|Q08387 Saccharomyces cerevisiae YOR005c DNL4 DNA ligase IV; RecName: Full=DNA ligase 4; EC=6.5.1.1; AltName: Full=DNA ligase IV; AltName: Full=Polydeoxyribonucleotide synthase [ATP] 4;

Protein domain map

Protein length: 956 amino acids
Protein family: GL3C0416
Database cross references:
Gene3D: G3DSA:2.40.50.140
InterPro: IPR000977
InterPro: IPR001357
InterPro: IPR012308
InterPro: IPR012309
InterPro: IPR012310
InterPro: IPR012340
InterPro: IPR016027
KEGG: yli:YALI0D21384g
PROSITE: PS50160
PROSITE: PS50172
Pfam: PF00533
Pfam: PF01068
Pfam: PF04675
Pfam: PF04679
RefSeq: XP_503109.1
SMART: SM00292
TIGRFAMs: TIGR00574
UniProtKB/Swiss-Prot: Q6C8A3
UniProtKB: DNLI4_YARLI

Computed results for YALI0D21384p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0D21384g.nt
ATGTCGAGCGAGCGGCGACCCGAGCTGGAAGAAACTGCCGTTGACCCGGCAACGGGCTCT
GCGGCGTCTCGAAAGTTTTCCATTGTCCAGGACGCGGTGGAAACGACAATTGTGGCACCG
ACCAACCATGGGCCCTCTCCTCGGTTTTCCACTCTCGTCCGCAACCTGTTCGAGCCGCTG
GTCAATCTCTCGGCCGTGGTTGCAGCTCTGCGCAAGAAACCGACCGAGGCCAAGGCTCAC
ATTGCCTCTCAGTTCATCAAGGGGTGGGTAGAGGAGGTTGGCAAGGACATTTATCCTGCC
TTCCGTCTCATCTTACCGGACAAAGACCGAGAACGGGCCGTGTACGGGCTCAAGGAAAAG
GCGCTGGGCCGTCTGTGGGTCAAGGTGCTCAATTTGGCCAAAGATTCGCCCGATGCCAAG
GCGTTGAGTGAATGGAAACAAGGAGGCAACGAAAGCGCCGGCAACTTCTCCAAACGGTGC
TACGAAGTGCTGAGCAAGCGAACCAGTCTTACCGACTACGGCCATATGACCGTGGACGAG
GTCAATGAGCGACTGGATCTTTTGGCCGACGGAGAAACGGACCAGGCCAAGCAGATTGAG
ATTCTAACCTACTTCTACAAGCACATGAACGCCACGGAGCTCAAATGGCTGGTGAATATC
ATTTTGCGGCAGATGAAGATGAACGCGACGGAAAAGGTGTTTTTTGAGCCCTGGCATCCC
GATGCCGAGTCCTTGTTCAACGTCACTGCCAGTTTGAAACGCGTCTGCTGGGAATTGACA
GATCCTACTAAACGGCTGACTTCCGCAGAGGCCCAAGTGTCGTTATTCGCCTGTTTCATG
CCGCAAATCGCCGCGTTTCCGAAATACTCGGGCCAGGACATTGCCGGAAAACACTTCAAG
GGCAGACCGTTCTACATTGAAGAAAAGATTGACGGAGAGAGAATGCAGATGCACATGAGC
GAATATGGCAACAAGTTCCACTGGTGGAGCAGACGGTCCAAGGACTTCACCGAGACGTAT
GGAAACTCTCTGGATGACGCTTCTGGCTCTCTGACCAAACGTCTTAGAGGTATCATCAAC
CCCAAAGTCAGAAACTGTGTGCTGGACGGCGAAATGGTGGCTTATGATCCTGCCACCAAG
AAGATTATCCCGTTTGGAACTCTGAGAACGGCCAACCGAAACGAACAGAACGACCTGAAC
CTCACTAAACCCATGTTCATGGTATTTGACATTCTTTTACTCAACGATAAGCCTCTGGTG
GACTACACTCTAGCTGAGCGCAAGAGAACACTTCGGACCATCTTTGCAAGGACTGATAAC
GAGACTGTGGGTCAGGAAGGAGTTCTGGAAGTGTTACCCTACACCGAGGCCACCACCGCT
GCTGAAATCGAGACTTGCATGCGAAAGATCATTGCAGAGTCGTCCGAAGGACTGGTCATC
AAAGACCCTACTTCTGTCTACAGGGTGAACACTCGAGACGATTCGTGGCTGAAAATGAAA
CCTGAGTACATGTCTGAATTCGGCGAGAAGCTCGATGTTGTCATTATTGGAGGCTACTAC
GGTTCAGGAAAACGAGGCAGTATTCTTTCCTCGTATCTTTGCGGTCTTCGGGCTGATGGA
TCGGACCAGTTTTGGTCCTTTTTCAAAGTGGGGGGTGGCCTGACTGCGGGTGACTACCAG
GCTATTCGCACCAAGACCGAGGGCAAATGGAAACGATGGGACAAGAACGACAAGCCCAAA
AACGTGCTTCTGGCGGGCCCCAATGGCGACCTAGAACGTCCAGATGTCTGGATCGAGCCG
TCGGACAGTGTGGTGGTCGAGGTCAAGGCTGCTTCAGTAGTTGCTAGTGACCAGTACAAG
GTGGGGTTGTGTCTGCGGTTTCCTAGATTCCGAGCCCTGCGACTGGATAAGACATGGGAA
GACGGACTGACCATTTCTCAGTTTGCGGAGCTCAGACAAACAGTTGAAATGGAGGCTGAA
AACAAGGAGTTGGAGCTGGAGGACAGAAAGAGACGCAATGCAGGTCCCGGAAGAGGGGCC
AAACGGCTGAAACTGGCAAACGTGTCTTCTGACGAAGACGAGCTGGGTACTGATGAAAGG
CCGACGTCTGTTTTCAAAGCCACGTCTTTTGCTGTGCTCTCAGACATGTCTTCTCCTCGG
TACATGTCTAAAGCCGCGGTGGAAAATCTCATCAAGAAGCACGGAGGTACTGTGTTTCAG
ACGGTCGAAGGACCACACACGATTCCCGTTGCAGACACCCGAACTATCAAGGTCCAGGCT
CTGACTAAACGGGTCCATGGTGTGGATGTGATTCGACCCAACTGGCTGTTGGATTGCATC
AACGAGGAGAAACTAGTGGCTCTGGAGCCGCGAAATCTGCTGGAGTCGAGTGCCGAAACA
CTTGCACTTGCCAAGACAAATGTCGACGAGTTTGGAGACAGTTACACCCGCCCTCTGACC
TACAAAGAGATGCAGGAGGTGTTGCGGTTCATGGACCAGTTTGATCTGGATCAAACAAAC
CCCCCTGACTTGATGATGGAGGTTCTGGAAACCAATGATGGAGCCGTGCCCAAGGGAATG
CTCTTCTATGGCAAAAAGGTGTACATGTCGACTTCCAATATGGACACTGTTGCTCTGGAG
ACCCAGTTCAGAGCCTACGACGCCTTGAGATGCCTGCAATTTGGAGGAGCCAATCTCGTG
ACCGACATGAAAGACCTGGTGGTGGCGGTTGCCAAAACGGAAGAGGAGGCTAAAGAGCTG
AGAAGGGTGTCCTCGGAACAGGTGTTTCCGTTCAGAGTGGTGTCCATCAAGTGGGTCGAG
GAGAGCTGGAAGAACGGAACGGTGGAGATTGAGGACGATTACCCTCTATAA

Coding sequence    

>YALI0D21384g.cds
ATGTCGAGCGAGCGGCGACCCGAGCTGGAAGAAACTGCCGTTGACCCGGCAACGGGCTCT
GCGGCGTCTCGAAAGTTTTCCATTGTCCAGGACGCGGTGGAAACGACAATTGTGGCACCG
ACCAACCATGGGCCCTCTCCTCGGTTTTCCACTCTCGTCCGCAACCTGTTCGAGCCGCTG
GTCAATCTCTCGGCCGTGGTTGCAGCTCTGCGCAAGAAACCGACCGAGGCCAAGGCTCAC
ATTGCCTCTCAGTTCATCAAGGGGTGGGTAGAGGAGGTTGGCAAGGACATTTATCCTGCC
TTCCGTCTCATCTTACCGGACAAAGACCGAGAACGGGCCGTGTACGGGCTCAAGGAAAAG
GCGCTGGGCCGTCTGTGGGTCAAGGTGCTCAATTTGGCCAAAGATTCGCCCGATGCCAAG
GCGTTGAGTGAATGGAAACAAGGAGGCAACGAAAGCGCCGGCAACTTCTCCAAACGGTGC
TACGAAGTGCTGAGCAAGCGAACCAGTCTTACCGACTACGGCCATATGACCGTGGACGAG
GTCAATGAGCGACTGGATCTTTTGGCCGACGGAGAAACGGACCAGGCCAAGCAGATTGAG
ATTCTAACCTACTTCTACAAGCACATGAACGCCACGGAGCTCAAATGGCTGGTGAATATC
ATTTTGCGGCAGATGAAGATGAACGCGACGGAAAAGGTGTTTTTTGAGCCCTGGCATCCC
GATGCCGAGTCCTTGTTCAACGTCACTGCCAGTTTGAAACGCGTCTGCTGGGAATTGACA
GATCCTACTAAACGGCTGACTTCCGCAGAGGCCCAAGTGTCGTTATTCGCCTGTTTCATG
CCGCAAATCGCCGCGTTTCCGAAATACTCGGGCCAGGACATTGCCGGAAAACACTTCAAG
GGCAGACCGTTCTACATTGAAGAAAAGATTGACGGAGAGAGAATGCAGATGCACATGAGC
GAATATGGCAACAAGTTCCACTGGTGGAGCAGACGGTCCAAGGACTTCACCGAGACGTAT
GGAAACTCTCTGGATGACGCTTCTGGCTCTCTGACCAAACGTCTTAGAGGTATCATCAAC
CCCAAAGTCAGAAACTGTGTGCTGGACGGCGAAATGGTGGCTTATGATCCTGCCACCAAG
AAGATTATCCCGTTTGGAACTCTGAGAACGGCCAACCGAAACGAACAGAACGACCTGAAC
CTCACTAAACCCATGTTCATGGTATTTGACATTCTTTTACTCAACGATAAGCCTCTGGTG
GACTACACTCTAGCTGAGCGCAAGAGAACACTTCGGACCATCTTTGCAAGGACTGATAAC
GAGACTGTGGGTCAGGAAGGAGTTCTGGAAGTGTTACCCTACACCGAGGCCACCACCGCT
GCTGAAATCGAGACTTGCATGCGAAAGATCATTGCAGAGTCGTCCGAAGGACTGGTCATC
AAAGACCCTACTTCTGTCTACAGGGTGAACACTCGAGACGATTCGTGGCTGAAAATGAAA
CCTGAGTACATGTCTGAATTCGGCGAGAAGCTCGATGTTGTCATTATTGGAGGCTACTAC
GGTTCAGGAAAACGAGGCAGTATTCTTTCCTCGTATCTTTGCGGTCTTCGGGCTGATGGA
TCGGACCAGTTTTGGTCCTTTTTCAAAGTGGGGGGTGGCCTGACTGCGGGTGACTACCAG
GCTATTCGCACCAAGACCGAGGGCAAATGGAAACGATGGGACAAGAACGACAAGCCCAAA
AACGTGCTTCTGGCGGGCCCCAATGGCGACCTAGAACGTCCAGATGTCTGGATCGAGCCG
TCGGACAGTGTGGTGGTCGAGGTCAAGGCTGCTTCAGTAGTTGCTAGTGACCAGTACAAG
GTGGGGTTGTGTCTGCGGTTTCCTAGATTCCGAGCCCTGCGACTGGATAAGACATGGGAA
GACGGACTGACCATTTCTCAGTTTGCGGAGCTCAGACAAACAGTTGAAATGGAGGCTGAA
AACAAGGAGTTGGAGCTGGAGGACAGAAAGAGACGCAATGCAGGTCCCGGAAGAGGGGCC
AAACGGCTGAAACTGGCAAACGTGTCTTCTGACGAAGACGAGCTGGGTACTGATGAAAGG
CCGACGTCTGTTTTCAAAGCCACGTCTTTTGCTGTGCTCTCAGACATGTCTTCTCCTCGG
TACATGTCTAAAGCCGCGGTGGAAAATCTCATCAAGAAGCACGGAGGTACTGTGTTTCAG
ACGGTCGAAGGACCACACACGATTCCCGTTGCAGACACCCGAACTATCAAGGTCCAGGCT
CTGACTAAACGGGTCCATGGTGTGGATGTGATTCGACCCAACTGGCTGTTGGATTGCATC
AACGAGGAGAAACTAGTGGCTCTGGAGCCGCGAAATCTGCTGGAGTCGAGTGCCGAAACA
CTTGCACTTGCCAAGACAAATGTCGACGAGTTTGGAGACAGTTACACCCGCCCTCTGACC
TACAAAGAGATGCAGGAGGTGTTGCGGTTCATGGACCAGTTTGATCTGGATCAAACAAAC
CCCCCTGACTTGATGATGGAGGTTCTGGAAACCAATGATGGAGCCGTGCCCAAGGGAATG
CTCTTCTATGGCAAAAAGGTGTACATGTCGACTTCCAATATGGACACTGTTGCTCTGGAG
ACCCAGTTCAGAGCCTACGACGCCTTGAGATGCCTGCAATTTGGAGGAGCCAATCTCGTG
ACCGACATGAAAGACCTGGTGGTGGCGGTTGCCAAAACGGAAGAGGAGGCTAAAGAGCTG
AGAAGGGTGTCCTCGGAACAGGTGTTTCCGTTCAGAGTGGTGTCCATCAAGTGGGTCGAG
GAGAGCTGGAAGAACGGAACGGTGGAGATTGAGGACGATTACCCTCTATAA

Predicted translation product    

>YALI0D21384g.aa
MSSERRPELEETAVDPATGSAASRKFSIVQDAVETTIVAPTNHGPSPRFSTLVRNLFEPL
VNLSAVVAALRKKPTEAKAHIASQFIKGWVEEVGKDIYPAFRLILPDKDRERAVYGLKEK
ALGRLWVKVLNLAKDSPDAKALSEWKQGGNESAGNFSKRCYEVLSKRTSLTDYGHMTVDE
VNERLDLLADGETDQAKQIEILTYFYKHMNATELKWLVNIILRQMKMNATEKVFFEPWHP
DAESLFNVTASLKRVCWELTDPTKRLTSAEAQVSLFACFMPQIAAFPKYSGQDIAGKHFK
GRPFYIEEKIDGERMQMHMSEYGNKFHWWSRRSKDFTETYGNSLDDASGSLTKRLRGIIN
PKVRNCVLDGEMVAYDPATKKIIPFGTLRTANRNEQNDLNLTKPMFMVFDILLLNDKPLV
DYTLAERKRTLRTIFARTDNETVGQEGVLEVLPYTEATTAAEIETCMRKIIAESSEGLVI
KDPTSVYRVNTRDDSWLKMKPEYMSEFGEKLDVVIIGGYYGSGKRGSILSSYLCGLRADG
SDQFWSFFKVGGGLTAGDYQAIRTKTEGKWKRWDKNDKPKNVLLAGPNGDLERPDVWIEP
SDSVVVEVKAASVVASDQYKVGLCLRFPRFRALRLDKTWEDGLTISQFAELRQTVEMEAE
NKELELEDRKRRNAGPGRGAKRLKLANVSSDEDELGTDERPTSVFKATSFAVLSDMSSPR
YMSKAAVENLIKKHGGTVFQTVEGPHTIPVADTRTIKVQALTKRVHGVDVIRPNWLLDCI
NEEKLVALEPRNLLESSAETLALAKTNVDEFGDSYTRPLTYKEMQEVLRFMDQFDLDQTN
PPDLMMEVLETNDGAVPKGMLFYGKKVYMSTSNMDTVALETQFRAYDALRCLQFGGANLV
TDMKDLVVAVAKTEEEAKELRRVSSEQVFPFRVVSIKWVEESWKNGTVEIEDDYPL*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites