YALI0D06325g


similar to uniprot|P52893 Saccharomyces cerevisiae YLR089C Putative alanine aminotransferase mitochondrial precursor

Genomic environment map

Element type: CDS
Element length: 1491 nucleotides,
on sense strand of
Yali0D: 812280..813770.
Other names:
YALI-CDS2374.1
YALI-IPF5320
Coding sequence: 497 codons.
Database cross references:
EMBL: CR382130
GeneID: 2910869
GenomeReviews: CR382130_GR
HOGENOM: HBG645860

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0967
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0D06325p  


similar to uniprot|P52893 Saccharomyces cerevisiae YLR089C Putative alanine aminotransferase mitochondrial precursor; SubName: Full=YALI0D06325p;

Protein domain map

Protein length: 496 amino acids
Protein family: GL3C0967
Database cross references:
Gene3D: G3DSA:3.40.640.10
Gene3D: G3DSA:3.90.1150.10
InterPro: IPR001176
InterPro: IPR004839
InterPro: IPR015421
InterPro: IPR015422
InterPro: IPR015424
KEGG: yli:YALI0D06325g
PRINTS: PR00753
Pfam: PF00155
RefSeq: XP_502480.1
UniProtKB/TrEMBL: Q6CA32
UniProtKB: Q6CA32_YARLI

Phylogeny  

PhylomeDB:YALI0D06325g

Computed results for YALI0D06325p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0D06325g.nt
ATGCTGAGACAGGGTATAAAGCGTGCGGTGGTGCATGCCCGAGCCGTACAGGCCGTGTGC
AAACGAACCAACATGACCATCACCAAAAAAGATCTCAACCCCCAGGTGGTCAACGCCCAG
TATGCCGTGCGAGGCAAGTTGGCGGTGCGGGCCGACGAAATCAAGGAGCAGATGCGAACC
AACCCGTCGCTGTTCCCCTTTGACAAGGTCATCAACGCCAACATTGGCAACCCCCAGCAG
CTCGACCAGAAGCCCGTCACTTTCTACCGCCAGGTCCTGGCTATGCTGCAGTACCCCGAG
TTGATGGATCGGGCCGCCGACGTGGGCATCCCCAACGACGCAGTGCAGCGTGCTCGAAAG
CTGCTGGACGACATTGGATCGGTCGGCGCCTACTCGTCGTCCCAGGGCGTCACCACCGTG
CGAAATTCGGTGGCTAACTTCATCCAAAAGCGAGACGGCTACGCAGCCTCGGCCTCCGAC
ATCTACCTCACCACAGGAGCCTCCAACGCCGTCACTTTTCTGCTCACAACTTTGGCTCGA
GGCGACGGATCGGACGGATTCATGATCCCCATTCCCCAGTATCCCCTTTACACCGCCACC
CTGACCCTGCAGAACTCCAACCCCGTCCCCTACTACCTGGACGAAGCCAAGGAGTGGGGC
ACCAACATGGCTGCTCTCAACGACGCCGTCGAGTCCTCCAAGCACAAGCTCAAGGCCGTC
GTGGTCATCAACCCCGGAAACCCCACCGGAGCTTGTCTCGGCGTCAAGGAAATCAAGGAC
ATTCTGCTGCTGGCACAGAAGGAGGGCATTGCCGTGATCGCCGACGAGGTCTACCAGGCC
AACATTTTTGCCTCTGGCCAGTTCCACTCCTTCAAAAAGGTCTGGTCCATTCTCAAGGAG
GAGAACCCCGACTTCAACGTGCCCCTGGCATCTCTGCATTCCACCTCCAAGGGCAAGATC
GGAGAGTGTGGCCAGCGAGGAGGCTACATGGAGCTCGTTGGTTTCCATGAGGACGTGATT
GAGCAGATCTACAAGCTCTGTTCCATCTCTCTGTGTCCCGTTGTCACCGGACAGGCTCTT
ATTGAGTGTATGGTCAACCCCCCCGTTGAGGGAGACGAATCGTACCCTCTGTTCAACAAG
GAAACCAACCACATTATGGATACTCTCACCCAGCGAGCCAACCGGCTGTACGAGGCCTTC
AAGGAGATGCCCAAGGTCTCCTGCGAGCCTCCCCAGGGCGCCATGTACCTGTTCCCCTCC
ATCGAGCTGCCTGCTGGCGCCATTGCCGAGGCCGAGCGACACAACGAGCAGCCCGACGAG
TTTTACTGCATGAAGCTGCTGGAGCAGACTGGTATCTGTGTTATTCCTGGCTCTGGATTT
GGCCAGAAGGATGGCACTTACCATTTCCGAACAACCTTCCTCGCACCTGGTGATGACTAC
GGAGAGAAGATTGTCAACTTCCACAAGAAGTTTTTGGCTCAGTACGAGTAA

Coding sequence    

>YALI0D06325g.cds
ATGCTGAGACAGGGTATAAAGCGTGCGGTGGTGCATGCCCGAGCCGTACAGGCCGTGTGC
AAACGAACCAACATGACCATCACCAAAAAAGATCTCAACCCCCAGGTGGTCAACGCCCAG
TATGCCGTGCGAGGCAAGTTGGCGGTGCGGGCCGACGAAATCAAGGAGCAGATGCGAACC
AACCCGTCGCTGTTCCCCTTTGACAAGGTCATCAACGCCAACATTGGCAACCCCCAGCAG
CTCGACCAGAAGCCCGTCACTTTCTACCGCCAGGTCCTGGCTATGCTGCAGTACCCCGAG
TTGATGGATCGGGCCGCCGACGTGGGCATCCCCAACGACGCAGTGCAGCGTGCTCGAAAG
CTGCTGGACGACATTGGATCGGTCGGCGCCTACTCGTCGTCCCAGGGCGTCACCACCGTG
CGAAATTCGGTGGCTAACTTCATCCAAAAGCGAGACGGCTACGCAGCCTCGGCCTCCGAC
ATCTACCTCACCACAGGAGCCTCCAACGCCGTCACTTTTCTGCTCACAACTTTGGCTCGA
GGCGACGGATCGGACGGATTCATGATCCCCATTCCCCAGTATCCCCTTTACACCGCCACC
CTGACCCTGCAGAACTCCAACCCCGTCCCCTACTACCTGGACGAAGCCAAGGAGTGGGGC
ACCAACATGGCTGCTCTCAACGACGCCGTCGAGTCCTCCAAGCACAAGCTCAAGGCCGTC
GTGGTCATCAACCCCGGAAACCCCACCGGAGCTTGTCTCGGCGTCAAGGAAATCAAGGAC
ATTCTGCTGCTGGCACAGAAGGAGGGCATTGCCGTGATCGCCGACGAGGTCTACCAGGCC
AACATTTTTGCCTCTGGCCAGTTCCACTCCTTCAAAAAGGTCTGGTCCATTCTCAAGGAG
GAGAACCCCGACTTCAACGTGCCCCTGGCATCTCTGCATTCCACCTCCAAGGGCAAGATC
GGAGAGTGTGGCCAGCGAGGAGGCTACATGGAGCTCGTTGGTTTCCATGAGGACGTGATT
GAGCAGATCTACAAGCTCTGTTCCATCTCTCTGTGTCCCGTTGTCACCGGACAGGCTCTT
ATTGAGTGTATGGTCAACCCCCCCGTTGAGGGAGACGAATCGTACCCTCTGTTCAACAAG
GAAACCAACCACATTATGGATACTCTCACCCAGCGAGCCAACCGGCTGTACGAGGCCTTC
AAGGAGATGCCCAAGGTCTCCTGCGAGCCTCCCCAGGGCGCCATGTACCTGTTCCCCTCC
ATCGAGCTGCCTGCTGGCGCCATTGCCGAGGCCGAGCGACACAACGAGCAGCCCGACGAG
TTTTACTGCATGAAGCTGCTGGAGCAGACTGGTATCTGTGTTATTCCTGGCTCTGGATTT
GGCCAGAAGGATGGCACTTACCATTTCCGAACAACCTTCCTCGCACCTGGTGATGACTAC
GGAGAGAAGATTGTCAACTTCCACAAGAAGTTTTTGGCTCAGTACGAGTAA

Predicted translation product    

>YALI0D06325g.aa
MLRQGIKRAVVHARAVQAVCKRTNMTITKKDLNPQVVNAQYAVRGKLAVRADEIKEQMRT
NPSLFPFDKVINANIGNPQQLDQKPVTFYRQVLAMLQYPELMDRAADVGIPNDAVQRARK
LLDDIGSVGAYSSSQGVTTVRNSVANFIQKRDGYAASASDIYLTTGASNAVTFLLTTLAR
GDGSDGFMIPIPQYPLYTATLTLQNSNPVPYYLDEAKEWGTNMAALNDAVESSKHKLKAV
VVINPGNPTGACLGVKEIKDILLLAQKEGIAVIADEVYQANIFASGQFHSFKKVWSILKE
ENPDFNVPLASLHSTSKGKIGECGQRGGYMELVGFHEDVIEQIYKLCSISLCPVVTGQAL
IECMVNPPVEGDESYPLFNKETNHIMDTLTQRANRLYEAFKEMPKVSCEPPQGAMYLFPS
IELPAGAIAEAERHNEQPDEFYCMKLLEQTGICVIPGSGFGQKDGTYHFRTTFLAPGDDY
GEKIVNFHKKFLAQYE*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites