YALI0C16753g


highly similar to ca|CA5757|IPF1067 Candida albicans Putative glutamate decarboxylase

Genomic environment map

Element type: CDS
Element length: 1494 nucleotides,
on anti-sense strand of
Yali0C: complement(2358297..2359790).
Other names:
YALI-CDS2369.1
YALI-IPF7040
Coding sequence: 498 codons.
Database cross references:
EMBL: CR382129
GeneID: 2909296
GenomeReviews: CR382129_GR
HOGENOM: HBG738168

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R4127
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0C16753p  


highly similar to ca|CA5757|IPF1067 Candida albicans Putative glutamate decarboxylase; SubName: Full=YALI0C16753p;

Protein domain map

Protein length: 497 amino acids
Protein family: GL3R4127
Database cross references:
Gene3D: G3DSA:3.40.640.10
Gene3D: G3DSA:3.90.1150.10
InterPro: IPR002129
InterPro: IPR015421
InterPro: IPR015422
InterPro: IPR015424
KEGG: yli:YALI0C16753g
PANTHER: PTHR11999
Pfam: PF00282
RefSeq: XP_501917.1
UniProtKB/TrEMBL: Q6CBP5
UniProtKB: Q6CBP5_YARLI

Phylogeny  

PhylomeDB:YALI0C16753g

Computed results for YALI0C16753p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0C16753g.nt
ATGACTGTTTCCAACGAAATCAAACCGCTACCGCAAGAGGCCAACCGGGTCCAGGACGCC
AAGGAGATTCTCGACCGCCTCGTGCCCAGAGTCATCGAGTACATTGACTCGGCTACCAAA
GAAGGATCCAAGGTGGGGCCGTCAGAAACCCCCCAGGAGATTCGAAAGCAGGTCGATCTG
ACGCTCCCCGAGAAGGGAGAGGGCATCGACGGTCTGTTCGAGTCGGTGGAACACGTGCTG
TCCAAATCGGTCAACACCTGGCACCCGGGCTTTCTCGATAAGCTGTACGCCTCCACCAAC
CCCGTCGGAGTGGCTTCGGACATCATTCTGTCTGTTCTCAACACAAACTCGCACGTGTAC
ACCGTGTCACCCATCCTGACTCTGATCGAAAAGTCCGTGGCCAAGCAGTATGCCGGCCTG
TTTGGTTTCAACGGCCCCCGGGCTGGTGGCCTCACCTTCCCGGGCGGATCGTACTCCAAC
ATCACCTCCATGGCCATGGCCCGAGCCATCAAGTATCCCGACACCAAGACCGAGGGCAAC
AGCGACTATAAGTTTGCCGTCTTCGCCTCTTCCCACTGCCACTACTCCGTCAAGAAGGCC
GCCATCCTGCTTGGTATTGGCCAGTCGCAGGTTCTGTCTATCGATGTTGACAAGGAGGGC
CGAATGATTGCCTCCGATCTCGCTGCAAAGATCGAGACCGCCAAGACCAAGGGCTACACT
CCTCTGTACATCAACGCGACCGCCGGAACCACCGTTTTTGGTTCCTACGATCCCTTCCAC
CAGATTGCCGAGATTGCCCAGAAGAACAACCTGTGGTTCCATATCGACGGATCGTGGGGA
GGAAACGTTTGTTTCTCTGACAAGTACAGATACAAGCTTGATGGTTCCGAGAAGGCAGAT
TCCATCACCGTCAACCCTCACAAAATGCTAGGTGTCCCCACCACATGCTCTTTCCTGCTT
GTTCCCGACGAGAACGCTTTCAAGACCGCAAACGCCCTGCAGGCTCCTTACCTGTTCCAC
GGCTCTAACGAAGAGGAGAACTTTGATCTTGCCGACGGCACCCTGGGTTGTGGGCGACGA
CCCGACGCCCTCAAGCTGTACCTCGGCTGGCAGTGGTTTGGAACCGAGGGCTACGGCAAG
CGAGTGGACCACGCGTTCGAGCTGACCAAGTACCTTGCCGAGCAGGTCCAGAACCGGCCT
GGATTTGAGCTTGTGTCCCAGTTTCCTCCTCCTTGTCTCCAGACGTGCTTCTACTACGCT
CCTAGCGGCTCTCTGGCTTCTGAGGCAAGTGCAAACTCGGACGCTACCCGGTTCATGGCC
AAGAAGCTGTATGACTCGGGCAAGTTCCTGGTCGACTATGCTCCCGAGCAGGGTGAGGGC
GGCCGAGGCGAGTTCTTCCGAGTCGTCATTAACGCTCCTACCGTGAGCTCCAAGACCGTT
GACGACCTGCTCAACGAGGTTGAGAGACTGGGTAAGGAGTACACCAAGAAGTAG

Coding sequence    

>YALI0C16753g.cds
ATGACTGTTTCCAACGAAATCAAACCGCTACCGCAAGAGGCCAACCGGGTCCAGGACGCC
AAGGAGATTCTCGACCGCCTCGTGCCCAGAGTCATCGAGTACATTGACTCGGCTACCAAA
GAAGGATCCAAGGTGGGGCCGTCAGAAACCCCCCAGGAGATTCGAAAGCAGGTCGATCTG
ACGCTCCCCGAGAAGGGAGAGGGCATCGACGGTCTGTTCGAGTCGGTGGAACACGTGCTG
TCCAAATCGGTCAACACCTGGCACCCGGGCTTTCTCGATAAGCTGTACGCCTCCACCAAC
CCCGTCGGAGTGGCTTCGGACATCATTCTGTCTGTTCTCAACACAAACTCGCACGTGTAC
ACCGTGTCACCCATCCTGACTCTGATCGAAAAGTCCGTGGCCAAGCAGTATGCCGGCCTG
TTTGGTTTCAACGGCCCCCGGGCTGGTGGCCTCACCTTCCCGGGCGGATCGTACTCCAAC
ATCACCTCCATGGCCATGGCCCGAGCCATCAAGTATCCCGACACCAAGACCGAGGGCAAC
AGCGACTATAAGTTTGCCGTCTTCGCCTCTTCCCACTGCCACTACTCCGTCAAGAAGGCC
GCCATCCTGCTTGGTATTGGCCAGTCGCAGGTTCTGTCTATCGATGTTGACAAGGAGGGC
CGAATGATTGCCTCCGATCTCGCTGCAAAGATCGAGACCGCCAAGACCAAGGGCTACACT
CCTCTGTACATCAACGCGACCGCCGGAACCACCGTTTTTGGTTCCTACGATCCCTTCCAC
CAGATTGCCGAGATTGCCCAGAAGAACAACCTGTGGTTCCATATCGACGGATCGTGGGGA
GGAAACGTTTGTTTCTCTGACAAGTACAGATACAAGCTTGATGGTTCCGAGAAGGCAGAT
TCCATCACCGTCAACCCTCACAAAATGCTAGGTGTCCCCACCACATGCTCTTTCCTGCTT
GTTCCCGACGAGAACGCTTTCAAGACCGCAAACGCCCTGCAGGCTCCTTACCTGTTCCAC
GGCTCTAACGAAGAGGAGAACTTTGATCTTGCCGACGGCACCCTGGGTTGTGGGCGACGA
CCCGACGCCCTCAAGCTGTACCTCGGCTGGCAGTGGTTTGGAACCGAGGGCTACGGCAAG
CGAGTGGACCACGCGTTCGAGCTGACCAAGTACCTTGCCGAGCAGGTCCAGAACCGGCCT
GGATTTGAGCTTGTGTCCCAGTTTCCTCCTCCTTGTCTCCAGACGTGCTTCTACTACGCT
CCTAGCGGCTCTCTGGCTTCTGAGGCAAGTGCAAACTCGGACGCTACCCGGTTCATGGCC
AAGAAGCTGTATGACTCGGGCAAGTTCCTGGTCGACTATGCTCCCGAGCAGGGTGAGGGC
GGCCGAGGCGAGTTCTTCCGAGTCGTCATTAACGCTCCTACCGTGAGCTCCAAGACCGTT
GACGACCTGCTCAACGAGGTTGAGAGACTGGGTAAGGAGTACACCAAGAAGTAG

Predicted translation product    

>YALI0C16753g.aa
MTVSNEIKPLPQEANRVQDAKEILDRLVPRVIEYIDSATKEGSKVGPSETPQEIRKQVDL
TLPEKGEGIDGLFESVEHVLSKSVNTWHPGFLDKLYASTNPVGVASDIILSVLNTNSHVY
TVSPILTLIEKSVAKQYAGLFGFNGPRAGGLTFPGGSYSNITSMAMARAIKYPDTKTEGN
SDYKFAVFASSHCHYSVKKAAILLGIGQSQVLSIDVDKEGRMIASDLAAKIETAKTKGYT
PLYINATAGTTVFGSYDPFHQIAEIAQKNNLWFHIDGSWGGNVCFSDKYRYKLDGSEKAD
SITVNPHKMLGVPTTCSFLLVPDENAFKTANALQAPYLFHGSNEEENFDLADGTLGCGRR
PDALKLYLGWQWFGTEGYGKRVDHAFELTKYLAEQVQNRPGFELVSQFPPPCLQTCFYYA
PSGSLASEASANSDATRFMAKKLYDSGKFLVDYAPEQGEGGRGEFFRVVINAPTVSSKTV
DDLLNEVERLGKEYTKK*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites