YALI0C06061g


similar to uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2 putative histone deacetylase

Genomic environment map

Element type: CDS
Element length: 1302 nucleotides,
on sense strand of
Yali0C: 778522..779823.
Other names:
YALI-CDS2937.1
YALI-IPF6543
Coding sequence: 434 codons.
Database cross references:
EMBL: CR382129
GeneID: 2909232
GenomeReviews: CR382129_GR
HOGENOM: HBG396919

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0276
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0C06061p  


similar to uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2 putative histone deacetylase; RecName: Full=Histone deacetylase; EC=3.5.1.98;

Protein domain map

Protein length: 433 amino acids
Protein family: GL3C0276
Database cross references:
Gene3D: G3DSA:3.40.800.20
InterPro: IPR000286
InterPro: IPR003084
InterPro: IPR023801
KEGG: yli:YALI0C06061g
PANTHER: PTHR10625
PIRSF: PIRSF037913
PRINTS: PR01270
PRINTS: PR01271
Pfam: PF00850
RefSeq: XP_501501.1
UniProtKB/TrEMBL: Q6CCW1
UniProtKB: Q6CCW1_YARLI

Phylogeny  

PhylomeDB:YALI0C06061g

Computed results for YALI0C06061p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0C06061g.nt
ATGTCAGAACCAACCATCGTGTTTGACTCCAAGACGGTGGAAAACACGCCTCTCTACGAG
TCGTTTCTGACGACACAAAAACGCCGCGTGTCGTACCATTTCAACGAGGAGGCTGCGCGA
TACCATTATGGAGTCCGTCACCCCATGAAACCGTTTCGACTCATGCTGACAGACCATCTG
GTGCTGGGATACAAGCTACACAACAAACTGGACTTGTACAGATCCCGAAGAGCCACAGAA
ACAGAGGTGCGGGAGTTCCACGCCGAAGAGTACATTGATTTCTTGCAACGTGTCACTCCG
GATAACATCAAAAAGTTCCAGCGAGTTTTACCCAAGTTTAACATTGGAGACGATTGTCCC
ATTTTCGACGGCATGTACGACTACTCGATCATTTACGCAGGTAGCAGTTTGGACGCGAGT
CGAAAGCTTCTTGCTGGCCAGTCAGATATCGCCATCAACTGGTCTGGAGGTCTGCATCAT
GCGAAAAAGTTTGAAGCCAGTGGATTCTGTTATGTGAACGACATTGTGTTGGCGATTCTG
AACCTTCTCAGAATGTATCCACGTGTTCTTTACATTGATATCGACATTCACCACGGAGAC
GGAGTGCAGGAGGCGTTCTATTCGACCGACCGAGTCATGACTCTGTCGTTCCACAAGTAT
AACGGAGAGTTCTTCCCTGGTACGGGAAACTTTGACGAGATTGGAACTAGTCTGGGCAAG
AACTACTCACTCAACGTGCCGCTACGAGACGGAATCGACGACGAGTCGTACGTGCGGCTG
TTCAAGAGTGTTTTAGAGCCTGTTCTCAACAGTTACAGACCCTCGGCTATTGTGCTTCAA
TGTGGAGCTGATTCGCTTGGTGGAGATCGTTTGGGATGTTTCAATCTCAACATCAAGGCC
CATGGAGAGTGCGTTGCATATACAAAGTCGTTTGGCCTGCCTCTGATTGTGCTTGGAGGA
GGAGGATACACCCCTCGCAACGTGTCTCGATTGTGGTGTTATGAGACCAGTGTGTGTCTG
GACGTTGATCTGGAGACTCGGTTGCCTTCTTCCATGCCTTTTCTCAAGTATTTTGCTCCA
GATTACTCGTTGCATCCCAACCTGGCTGGTAAGATCGACAACAAGAACTCCCGCAAGTTT
CTGGATTCTGTGCATGTGCAGGTGATGGAACAGCTGAGAACTTTGCAGGGAGCCCCCAGT
GTTCAGATGGCTGAAATTCCGCCGGACCTGGCCGGTCTGACTGAGGAGGGAGAAAAGCAG
CGACGAGATGAGCTTGACGAGGCGATGAAGGATGCGAGGTAG

Coding sequence    

>YALI0C06061g.cds
ATGTCAGAACCAACCATCGTGTTTGACTCCAAGACGGTGGAAAACACGCCTCTCTACGAG
TCGTTTCTGACGACACAAAAACGCCGCGTGTCGTACCATTTCAACGAGGAGGCTGCGCGA
TACCATTATGGAGTCCGTCACCCCATGAAACCGTTTCGACTCATGCTGACAGACCATCTG
GTGCTGGGATACAAGCTACACAACAAACTGGACTTGTACAGATCCCGAAGAGCCACAGAA
ACAGAGGTGCGGGAGTTCCACGCCGAAGAGTACATTGATTTCTTGCAACGTGTCACTCCG
GATAACATCAAAAAGTTCCAGCGAGTTTTACCCAAGTTTAACATTGGAGACGATTGTCCC
ATTTTCGACGGCATGTACGACTACTCGATCATTTACGCAGGTAGCAGTTTGGACGCGAGT
CGAAAGCTTCTTGCTGGCCAGTCAGATATCGCCATCAACTGGTCTGGAGGTCTGCATCAT
GCGAAAAAGTTTGAAGCCAGTGGATTCTGTTATGTGAACGACATTGTGTTGGCGATTCTG
AACCTTCTCAGAATGTATCCACGTGTTCTTTACATTGATATCGACATTCACCACGGAGAC
GGAGTGCAGGAGGCGTTCTATTCGACCGACCGAGTCATGACTCTGTCGTTCCACAAGTAT
AACGGAGAGTTCTTCCCTGGTACGGGAAACTTTGACGAGATTGGAACTAGTCTGGGCAAG
AACTACTCACTCAACGTGCCGCTACGAGACGGAATCGACGACGAGTCGTACGTGCGGCTG
TTCAAGAGTGTTTTAGAGCCTGTTCTCAACAGTTACAGACCCTCGGCTATTGTGCTTCAA
TGTGGAGCTGATTCGCTTGGTGGAGATCGTTTGGGATGTTTCAATCTCAACATCAAGGCC
CATGGAGAGTGCGTTGCATATACAAAGTCGTTTGGCCTGCCTCTGATTGTGCTTGGAGGA
GGAGGATACACCCCTCGCAACGTGTCTCGATTGTGGTGTTATGAGACCAGTGTGTGTCTG
GACGTTGATCTGGAGACTCGGTTGCCTTCTTCCATGCCTTTTCTCAAGTATTTTGCTCCA
GATTACTCGTTGCATCCCAACCTGGCTGGTAAGATCGACAACAAGAACTCCCGCAAGTTT
CTGGATTCTGTGCATGTGCAGGTGATGGAACAGCTGAGAACTTTGCAGGGAGCCCCCAGT
GTTCAGATGGCTGAAATTCCGCCGGACCTGGCCGGTCTGACTGAGGAGGGAGAAAAGCAG
CGACGAGATGAGCTTGACGAGGCGATGAAGGATGCGAGGTAG

Predicted translation product    

>YALI0C06061g.aa
MSEPTIVFDSKTVENTPLYESFLTTQKRRVSYHFNEEAARYHYGVRHPMKPFRLMLTDHL
VLGYKLHNKLDLYRSRRATETEVREFHAEEYIDFLQRVTPDNIKKFQRVLPKFNIGDDCP
IFDGMYDYSIIYAGSSLDASRKLLAGQSDIAINWSGGLHHAKKFEASGFCYVNDIVLAIL
NLLRMYPRVLYIDIDIHHGDGVQEAFYSTDRVMTLSFHKYNGEFFPGTGNFDEIGTSLGK
NYSLNVPLRDGIDDESYVRLFKSVLEPVLNSYRPSAIVLQCGADSLGGDRLGCFNLNIKA
HGECVAYTKSFGLPLIVLGGGGYTPRNVSRLWCYETSVCLDVDLETRLPSSMPFLKYFAP
DYSLHPNLAGKIDNKNSRKFLDSVHVQVMEQLRTLQGAPSVQMAEIPPDLAGLTEEGEKQ
RRDELDEAMKDAR*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites