YALI0B20086g


weakly similar to uniprot|P10662 Saccharomyces cerevisiae YDR347W Mitochondrial 40S ribosomal protein MRP1

Genomic environment map

Element type: CDS
Element length: 1041 nucleotides,
on anti-sense strand of
Yali0B: complement(2643941..2644981).
Other names:
YALI-CDS3831.1
YALI-IPF8483
Coding sequence: 347 codons.
Database cross references:
EMBL: CR382128
GeneID: 2906892
GenomeReviews: CR382128_GR

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0305
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0B20086p  


weakly similar to uniprot|P10662 Saccharomyces cerevisiae YDR347W Mitochondrial 40S ribosomal protein MRP1; SubName: Full=YALI0B20086p;

Protein domain map

Protein length: 346 amino acids
Protein family: GL3C0305
Database cross references:
InterPro: IPR001189
InterPro: IPR019832
KEGG: yli:YALI0B20086g
PANTHER: PTHR11404
Pfam: PF02777
RefSeq: XP_501122.1
UniProtKB/TrEMBL: Q6CDZ0
UniProtKB: Q6CDZ0_YARLI

Phylogeny  

PhylomeDB:YALI0B20086g

Computed results for YALI0B20086p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0B20086g.nt
ATGCTATCTCTTCGACGAGCTCTTCTGGTGCCCCGGCTGGGCCGGGCTCTGCACACCATG
CCTGCATACTCTGGCCTCGGCTCTCAGGCCGCTCCCACTCAGATCAACAAGTTTCTGTCG
GCCGAGACCGTCAAGTCTGCGTGGTTTGAACATCAGCACGAGATGCTGGAGCGAGTCAAC
GAGGGTCTGGCAAGCAGCGAGGAGCTGGAGGGTCTTGATCTGCAGAGTTTGGCTCTGGAA
ACTTGCAACCGGTCCGAGGATGCTCTCCACCACTTTGCTTCTGGAGCTTTTGCCAACGAT
TTCTTCTTCAAGGGTGTAGCTTCTACTGTCAAGCCCGGTGAGGTCTCTGAGCCCATTGAT
GCGTACCACGGACTCTACGTCAGCCCCCGAGACCCCGATTACCAGACTGTGATGCCTGCT
CTGGCCACCGGAGAGACCCCTGCTTGGGGCAACCACCCCGGCACTGACGATGCTCTGTAC
GACCTGATCCTGACGTCGTTCGGTACTGTGGAGGCCTTCCGAGAACATCTGCTGACCAAG
GCCGAGTCGATTTTCGGCAATGGATACACATGGCTAGTGCTGAGCAAGCACTCTGGCCGA
CTACATCTCGTCAACACCTACAACAACGGCTTCATCCAGAAGAAGGGCACCAACTCTGCC
GAGCTGGCTGCAGAGGCTGCTGCCAAGCGAGCCGTCGAGGCTGATGAGGCGAAGGCTCTG
GCTGAGCTCCAGGCCGAGGCTCAGAACAAGAAGCTTAACGCTCTGGAGGAGAAGCTTCTG
AAGAACAAAATCTACAAGATGGAGGTGGCCAAGCAGATGCGACAGGCACAGCCCAAGATT
CTGCACGATCTCAAGCCGCTGCTTAACGTCAACGTGTGGCAGCACATGTGGCTCAACGAC
TACGGCGCGTTTGGCAAGCGAAAGTACCTCGACAACTTCTGGGAGAAGATTGACTGGAAC
GTCGTCAAGGGACGACTCCAGGACCACTTTGAGAAGCAGACAGATCTTAGCAAGAGTGAG
CTGTTTGGACCTTACGTTTAA

Coding sequence    

>YALI0B20086g.cds
ATGCTATCTCTTCGACGAGCTCTTCTGGTGCCCCGGCTGGGCCGGGCTCTGCACACCATG
CCTGCATACTCTGGCCTCGGCTCTCAGGCCGCTCCCACTCAGATCAACAAGTTTCTGTCG
GCCGAGACCGTCAAGTCTGCGTGGTTTGAACATCAGCACGAGATGCTGGAGCGAGTCAAC
GAGGGTCTGGCAAGCAGCGAGGAGCTGGAGGGTCTTGATCTGCAGAGTTTGGCTCTGGAA
ACTTGCAACCGGTCCGAGGATGCTCTCCACCACTTTGCTTCTGGAGCTTTTGCCAACGAT
TTCTTCTTCAAGGGTGTAGCTTCTACTGTCAAGCCCGGTGAGGTCTCTGAGCCCATTGAT
GCGTACCACGGACTCTACGTCAGCCCCCGAGACCCCGATTACCAGACTGTGATGCCTGCT
CTGGCCACCGGAGAGACCCCTGCTTGGGGCAACCACCCCGGCACTGACGATGCTCTGTAC
GACCTGATCCTGACGTCGTTCGGTACTGTGGAGGCCTTCCGAGAACATCTGCTGACCAAG
GCCGAGTCGATTTTCGGCAATGGATACACATGGCTAGTGCTGAGCAAGCACTCTGGCCGA
CTACATCTCGTCAACACCTACAACAACGGCTTCATCCAGAAGAAGGGCACCAACTCTGCC
GAGCTGGCTGCAGAGGCTGCTGCCAAGCGAGCCGTCGAGGCTGATGAGGCGAAGGCTCTG
GCTGAGCTCCAGGCCGAGGCTCAGAACAAGAAGCTTAACGCTCTGGAGGAGAAGCTTCTG
AAGAACAAAATCTACAAGATGGAGGTGGCCAAGCAGATGCGACAGGCACAGCCCAAGATT
CTGCACGATCTCAAGCCGCTGCTTAACGTCAACGTGTGGCAGCACATGTGGCTCAACGAC
TACGGCGCGTTTGGCAAGCGAAAGTACCTCGACAACTTCTGGGAGAAGATTGACTGGAAC
GTCGTCAAGGGACGACTCCAGGACCACTTTGAGAAGCAGACAGATCTTAGCAAGAGTGAG
CTGTTTGGACCTTACGTTTAA

Predicted translation product    

>YALI0B20086g.aa
MLSLRRALLVPRLGRALHTMPAYSGLGSQAAPTQINKFLSAETVKSAWFEHQHEMLERVN
EGLASSEELEGLDLQSLALETCNRSEDALHHFASGAFANDFFFKGVASTVKPGEVSEPID
AYHGLYVSPRDPDYQTVMPALATGETPAWGNHPGTDDALYDLILTSFGTVEAFREHLLTK
AESIFGNGYTWLVLSKHSGRLHLVNTYNNGFIQKKGTNSAELAAEAAAKRAVEADEAKAL
AELQAEAQNKKLNALEEKLLKNKIYKMEVAKQMRQAQPKILHDLKPLLNVNVWQHMWLND
YGAFGKRKYLDNFWEKIDWNVVKGRLQDHFEKQTDLSKSELFGPYV*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites