YALI0B16742g


weakly similar to uniprot|P47141 Saccharomyces cerevisiae YJR101w RSM26 weak similarity to superoxide dismutases singleton

Genomic environment map

Element type: CDS
Element length: 783 nucleotides,
on sense strand of
Yali0B: 2202238..2203020.
Other names:
YALI-CDS4803.1
YALI-IPF8889
Coding sequence: 261 codons.
Database cross references:
EMBL: CR382128
GeneID: 2907154
GenomeReviews: CR382128_GR
HOGENOM: HBG397438

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0305
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0B16742p  


weakly similar to uniprot|P47141 Saccharomyces cerevisiae YJR101w RSM26 weak similarity to superoxide dismutases singleton; SubName: Full=YALI0B16742p;

Protein domain map

Protein length: 260 amino acids
Protein family: GL3C0305
Database cross references:
InterPro: IPR001189
InterPro: IPR019831
InterPro: IPR019832
KEGG: yli:YALI0B16742g
PANTHER: PTHR11404
Pfam: PF02777
RefSeq: XP_500987.1
UniProtKB/TrEMBL: Q6CEC5
UniProtKB: Q6CEC5_YARLI

Phylogeny  

PhylomeDB:YALI0B16742g

Computed results for YALI0B16742p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0B16742g.nt
ATGTTTCGAAACGTGATTAGCCGAGCCAAAGTGACCCAGATCGGCTCGATCCGATCCATC
CACACCCCCGCCAAGCTTTCACGAGAGTCCAAGTACGCCCAGAACGGCCTGGAGGGTCTG
TACTCCAAAAACGGCTTCAACACCGCTTGGACCGACTACCAGCGGTTCCTGGTGTCCAAG
CTCACTGACCTGACCGTCGACACTCCTCTGCAATCGCGATCCCCTTTTGATATTTTGCGA
TTCACTGCCGCCGACCGAGATCAGGCTGCTACATTCAACTTTGCCTCTCAAGCCTTCAAC
AACCACTTTTTCTTCGAGGCTCTGGCCGAGAAGCCCGTGGCCCAGACCACAGCGCCGACA
GACTACCTGCGTTCTCGACTGGAGGACAAGTTCGAGTCCATGGAGCGAGCCCGAGAGAAC
TTTTTGGCTACCGCCGACGAGATGACCGGAAACGGATGGGTCTTCCTCTACGAGGGAGGA
GACAAGAACATGTACATTTCGGCTCACCACAACGCAGGATCTCCCTTTTCGTTCCAGCGA
TTCCAGCATCAAGAATTCAACTTCCCCGCCTCCGAGGAGGTCAAGCGGGACCAGCAAAAC
ATTGAGGCTGCTGTGCGAAAGGGCCTCAAGGAGTCCATCCTGCCTCTGCTGGCCGTCAAT
GTGTGGCAGCAAGCCTACGTGGACGACTACGGAGTCAACGGCAAGTACAATTACTTGGAG
AACTATTGGGAGTGTATTAACTGGGATGTTGTCAACGCTAGACTGTTTGTTGGTGCCCAG
TAA

Coding sequence    

>YALI0B16742g.cds
ATGTTTCGAAACGTGATTAGCCGAGCCAAAGTGACCCAGATCGGCTCGATCCGATCCATC
CACACCCCCGCCAAGCTTTCACGAGAGTCCAAGTACGCCCAGAACGGCCTGGAGGGTCTG
TACTCCAAAAACGGCTTCAACACCGCTTGGACCGACTACCAGCGGTTCCTGGTGTCCAAG
CTCACTGACCTGACCGTCGACACTCCTCTGCAATCGCGATCCCCTTTTGATATTTTGCGA
TTCACTGCCGCCGACCGAGATCAGGCTGCTACATTCAACTTTGCCTCTCAAGCCTTCAAC
AACCACTTTTTCTTCGAGGCTCTGGCCGAGAAGCCCGTGGCCCAGACCACAGCGCCGACA
GACTACCTGCGTTCTCGACTGGAGGACAAGTTCGAGTCCATGGAGCGAGCCCGAGAGAAC
TTTTTGGCTACCGCCGACGAGATGACCGGAAACGGATGGGTCTTCCTCTACGAGGGAGGA
GACAAGAACATGTACATTTCGGCTCACCACAACGCAGGATCTCCCTTTTCGTTCCAGCGA
TTCCAGCATCAAGAATTCAACTTCCCCGCCTCCGAGGAGGTCAAGCGGGACCAGCAAAAC
ATTGAGGCTGCTGTGCGAAAGGGCCTCAAGGAGTCCATCCTGCCTCTGCTGGCCGTCAAT
GTGTGGCAGCAAGCCTACGTGGACGACTACGGAGTCAACGGCAAGTACAATTACTTGGAG
AACTATTGGGAGTGTATTAACTGGGATGTTGTCAACGCTAGACTGTTTGTTGGTGCCCAG
TAA

Predicted translation product    

>YALI0B16742g.aa
MFRNVISRAKVTQIGSIRSIHTPAKLSRESKYAQNGLEGLYSKNGFNTAWTDYQRFLVSK
LTDLTVDTPLQSRSPFDILRFTAADRDQAATFNFASQAFNNHFFFEALAEKPVAQTTAPT
DYLRSRLEDKFESMERARENFLATADEMTGNGWVFLYEGGDKNMYISAHHNAGSPFSFQR
FQHQEFNFPASEEVKRDQQNIEAAVRKGLKESILPLLAVNVWQQAYVDDYGVNGKYNYLE
NYWECINWDVVNARLFVGAQ*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites