YALI0B08921g


similar to uniprot|O13401 Candida albicans Superoxide dismutase [Mn] mitochondrial precursor (EC 1.15. 1.1)

Genomic environment map

Element type: CDS
Element length: 690 nucleotides,
on sense strand of
Yali0B: 1221137..1221826.
Other names:
YALI-CDS5130.1
YALI-IPF8620
Coding sequence: 230 codons.
Database cross references:
EMBL: CR382128
GeneID: 2907361
GenomeReviews: CR382128_GR
HOGENOM: HBG507761

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R0795
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0B08921p  


similar to uniprot|O13401 Candida albicans Superoxide dismutase [Mn] mitochondrial precursor (EC 1.15. 1.1); RecName: Full=Superoxide dismutase; EC=1.15.1.1;

Protein domain map

Protein length: 229 amino acids
Protein family: GL3R0795
Database cross references:
InterPro: IPR001189
InterPro: IPR019831
InterPro: IPR019832
InterPro: IPR019833
KEGG: yli:YALI0B08921g
PANTHER: PTHR11404
PIRSF: PIRSF000349
PRINTS: PR01703
PROSITE: PS00088
Pfam: PF00081
Pfam: PF02777
RefSeq: XP_500661.1
UniProtKB/TrEMBL: Q6CFA1
UniProtKB: Q6CFA1_YARLI

Phylogeny  

PhylomeDB:YALI0B08921g

Computed results for YALI0B08921p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0B08921g.nt
ATGCTCGCCCGAAACACTCTTCGACAGACCATTCGAAAGGCCCAGCCCATGGCCGGCCGA
ACCCTGACCACCGCCGTTCTGCCCAAGCTGGACTACGACTTTGGCGCCCTGGAGCCCTTT
GTGGCCGGCCAGATCAACGAGATCCACTACACCAAGCACCACCAGACCTACGTCAACTCG
TTCAACGCCGCCTCCGAGCAGCTGGCCTCCGCCGAGAAGGACGGAGACCTCAAGAAGATT
GTCGAGCTGCAGAACCTGATCAACTTCCACGGCGGAGGACACATCAACCACTCTCTGTGG
TGGAAGAACCTGGCTCCCAAGGGCCAGGGTGGAGGCGAGCTGCCTTCTCCCGACTCGCCT
CTCGGCAAGGCCATCAAGGAGCAGTGGGGAGACGCCAACAAGCTGATCGAAACCACCAAC
GCTGCTCTCGCCGGTGTCCAGGGCTCCGGATGGGCCTGGATCGTCAAGAACAAGCTCACC
GGTGACATCGAGGTCATCACCAAGCAGAACCAGGACCCCGTGGCCGGCAACCACATCCCT
CTCGTCGGTATCGACGCCTGGGAGCACGCCTACTACCTCCAGTACAAGAACGTCAAGGCT
GACTACTTCAAGGCCATCTGGAACGTCATCAACTGGCAGGAGGCTGAGAAGCGATTCCTC
GGTGAGGCCAAGTTTGTCAACGGCCAGTAA

Coding sequence    

>YALI0B08921g.cds
ATGCTCGCCCGAAACACTCTTCGACAGACCATTCGAAAGGCCCAGCCCATGGCCGGCCGA
ACCCTGACCACCGCCGTTCTGCCCAAGCTGGACTACGACTTTGGCGCCCTGGAGCCCTTT
GTGGCCGGCCAGATCAACGAGATCCACTACACCAAGCACCACCAGACCTACGTCAACTCG
TTCAACGCCGCCTCCGAGCAGCTGGCCTCCGCCGAGAAGGACGGAGACCTCAAGAAGATT
GTCGAGCTGCAGAACCTGATCAACTTCCACGGCGGAGGACACATCAACCACTCTCTGTGG
TGGAAGAACCTGGCTCCCAAGGGCCAGGGTGGAGGCGAGCTGCCTTCTCCCGACTCGCCT
CTCGGCAAGGCCATCAAGGAGCAGTGGGGAGACGCCAACAAGCTGATCGAAACCACCAAC
GCTGCTCTCGCCGGTGTCCAGGGCTCCGGATGGGCCTGGATCGTCAAGAACAAGCTCACC
GGTGACATCGAGGTCATCACCAAGCAGAACCAGGACCCCGTGGCCGGCAACCACATCCCT
CTCGTCGGTATCGACGCCTGGGAGCACGCCTACTACCTCCAGTACAAGAACGTCAAGGCT
GACTACTTCAAGGCCATCTGGAACGTCATCAACTGGCAGGAGGCTGAGAAGCGATTCCTC
GGTGAGGCCAAGTTTGTCAACGGCCAGTAA

Predicted translation product    

>YALI0B08921g.aa
MLARNTLRQTIRKAQPMAGRTLTTAVLPKLDYDFGALEPFVAGQINEIHYTKHHQTYVNS
FNAASEQLASAEKDGDLKKIVELQNLINFHGGGHINHSLWWKNLAPKGQGGGELPSPDSP
LGKAIKEQWGDANKLIETTNAALAGVQGSGWAWIVKNKLTGDIEVITKQNQDPVAGNHIP
LVGIDAWEHAYYLQYKNVKADYFKAIWNVINWQEAEKRFLGEAKFVNGQ*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites